Dataset B

From Icbwiki

Jump to: navigation, search

This page provides the second set of data supplied by the Gross lab. Each sequence contains an S-nitrosylated CYS residue. See also Dataset A.

Protein,SwissProt#,Sequence
Calatase,P04762,LGPNYLQIPVNCPYR
Potassium-transporting ATPase alpha chain 1,P09626,LVIVESCQRLGAIVAVTGDGVNDSPALK
Glutamate dehydrogenase,P10860,VYEGSILEADCDILIPAASEK
Sodium/potassium-transporting ATPase alpha-4 chain,Q9WV27,NLEAVETLGSTSTICSDKTGTLTQNR
Low-density lipoprotein receptor-related protein 2 ,P98158,GSYECFCVDGFK
Dihydropyrimidinase related protein-4,O35098,SHNLNVEYNIFEGVECR
Receptor-type tyrosine-protein phosphatase R,Q62132,NSTSTSVCPSPFRMKPIGLQER
"Hexokinase, type I",P05708,ATDCEGHDVASLLR
Spectrin alpha chain,P16086,CTELNQAWTSLGK
,,DCEQAENWMAAR
,,EQADYCVSHMKPYVDGK
,,
Adapter-related protein complex 2 beta 1 subunit,Q9DBG3,DCEDPNPLIR
Alpha-actinin 1,Q7TPR4,MVSDINNAWGCLEQAEK
4-aminobutyrate aminotransferase,P61922,TMGCLATTHSK
"2',3'-cyclic-nucleotide 3'-phosphodiesterase",P13233,LDEDLAGYCR
14-3-3 protein zeta/delta,P63101,YDDMAACMK
Succinyl-CoA ligase,Q9Z219,ICNQVLVCER
,,ILACDDLDEAAK
Nck-associated protein 1,P55161,NLITDICTEQCTLSDQLLPK
Actin-like protein 3,Q99JY9,DYEEIGPSICR
Vesicle-associated membrane protein-associated protein A,Q9WV55,CVFEMPNENDK
ATP synthase D chain,P31399,NCAQFVTGSQAR
Ubiquitin-activating enzyme E1 1,Q02053,DNPGVVTCLDEAR
NAD-dependent deacetylase sirtuin 2,Q8VDQ8,CYTQNIDTLER
Amphiphysin,Q7TQF7,CDVLWEDFHQK
Transcription elongation factor B polypeptide 1,P83940,TYGGCEGPDAMYVK
Profilin-1,P62962,CYEMASHLR
Nucleoside diphosphate kinase B,Q01768,GDFCIQVGR
Chloride intracellular channel protein 4,Q9QYB1,TDVNKIEEFLEEVLCPPK
Glutamine synthetas,P09606,CIEEAIDK
Glutamate--cysteine ligase catalytic subunit,P19468,EATSVLGEHQALCTITSFPR
,,GYVSDIDCR
Talin 1,P26039,AQEACGPLEMDSALSVVQNLEK
,,ASAGPQPLLVQSCK
"Myosin heavy chain, nonmuscle type A",Q62812,CQYLQAEK
,,EDQSILCTGESGAGK
,,MEDGVGCLETAEEAK
Kynurenine/alpha-aminoadipate aminotransferase,Q64602,LHNPPTVNYSPNEGQMDLCITSGCQDGLCK
Selenium-binding protein 2,Q63836,GGSVQVLEDQELTCQPEPLVVK
Succinyl-CoA ligase,Q9Z219,ILACDDLDEAAK
5-oxoprolinase,P97608,LEEQCVDALQVQGFPR
Personal tools