GeneTools
From Icbwiki
geneTools
Related pages
NGS Pipeline
This program generates scripts for pre-processing reads, performing QC analysis, doing sequence alignment (TopHat, BWA), visualization, etc.
scripts/pipelineSeq.pl
Example 1
Assuming raw sequences were generated by Illumina Casava 1.8 and are stored in those big TAR files. After untarring them the reads are stored in Sample_name_R1_*.fastq.gz in data/Sample_*/ subdirectories. The following commands will:
- Filter the raw reads by Illumina pass-filter tags and base quality.
- Run BWA to align all these split small FASTQ files in parallel.
- Convert the output SAM file to BAM format.
- Split the SAM alignments by chromosome for SNVseeqer/CHIPseeqer.
- Generate raw/unique read frequency files.
- Generate wiggle tracks for visualization on the UCSC genome browser (will be uploaded to tmp_web_output/ on a local server).
# Generate lists containing files to process
for i in `ls -d data/Sample_*/` ; do
outfile=${i}/seq_files.list
ls $i/*.fastq.gz > $outfile
done
# Generate and submit scripts
for i in `ls -d data/Sample_*`; do
samplename=`basename $i`
./pipelineSeq.pl -list data/${samplename}/seq_files.list -mem 3g -time 5:00:00 -type chip -webdir tmp_web_output \
--filter -out alignments_chip/$samplename --casava18 -tag $samplename
# submit Sun Grid Engine jobs
qsub qALN_CHIP_${samplename}.sh
qsub -h qALN_CHIP_${samplename}_post.sh
qalter -hold_jid qALN_CHIP_${samplename}.sh qALN_CHIP_${samplename}_post.sh
qalter -h U qALN_CHIP_${samplename}_post.sh
done
Example 2
The following command will generate an SGE script (qALN_XXX_YYY.sh) that aligns the single-end FASTQ file against the hg19 genome with TopHat (using 4 CPUs), generates a BAM file, removes duplicates, generates read density tracks (raw + unique), and calculates the RPKM values.
./pipelineSeq.pl -i Sample1.fastq.gz -o output/ --rpkm -cpu 4 -sge _XXX_ -tag YYY -ref hg19 --nouploadwig
Processing FASTQ files
Filter and trim single-end reads
The following command keeps the nucleotides in positions 0-24 (total length of 25 bp) and filters out trimmed reads that have low quality (average score < 30.0).
./geneModel seq -cmd trimse -f data/sample_1_sequence.txt.gz -s 0 -len 25 -minscore 30.0 -o output/trimmed_sample_1_sequence.txt.gz
Options:
-f FASTQ file
-o Output FASTQ file
-start Starting read position (0-based)
-len Output read length
-minscore Minimum average quality score in each trimmed read (default: 30.0)
--casava18 Indicate that the file is in CASAVA 1.8 format
--PF If input file is in CASAVA 1.8 format, further filter based on the Pass Filter tag
Filter and trim paired-end reads
The following command keeps the nucleotides in positions 0-24 (total length of 25 bp) and filters out trimmed reads that have low quality (either end with average score < 30.0). The read identifiers are output in the same order in the resulting RD1 and RD2 files.
./geneModel seq -cmd trimpe -f1 data/sample_1_sequence.txt.gz -f2 data/sample_2_sequence.txt.gz -s 0 -len 25 -minscore 30.0
-o1 output/trimmed_sample_1_sequence.txt.gz -o2 output/trimmed_sample_2_sequence.txt.gz
Options:
-f1 FASTQ file 1
-f2 FASTQ file 2
-o1 Output FASTQ file 1
-o2 Output FASTQ file 2
-start Starting read position (0-based)
-len Output read length
-minscore Minimum average quality score in each trimmed read (default: 30.0)
--casava18 Indicate that the files are in CASAVA 1.8 format
--PF If input files are in CASAVA 1.8 format, further filter based on the Pass Filter tag
Display numerical Phred score values
The following command converts the ASCII Phred codes to their numerical values.
./geneModel phred -seq 'be^eb]^^Ueef^fZabSbaag[QgdadbffdbG]YIXO[`]edb_f_T^Xe_ecbfeebcf\ffcfdff_BBBB'
Estimate insert size from paired-end reads
scripts/getInsertSize.pl estimates the average insert size from paired-end reads (FASTQ format). Insert size is defined as total selected fragment size - 2 * read length unless --total is specified.
Options:
-i FASTQ file for RD1
-j FASTQ file for RD2
-o Output file containing all insert sizes for all reads (optional)
-log Output file containing mean and median insert sizes
-ref Reference genome sequences
--total Report as insert size the average total length of the selected fragments (i.e. between the start
coordinate of the left read in the read-pair and the end coordinate of the right read in the read-pair)
-help
NOTE:
- To run this program you need the bowtie aligner, a reference human genome, and its bowtie indices.
Alignment/SAM related
Convert RefSeq-based alignments to genome-based alignments
./geneModel align -cmd ref2g -i bwa_ref.sam -o bwa_genome.sam
Options:
-i input sam file
-o output sam file
-ref RefSeq data file
scripts/quickSAM2BAM.pl bwa_genome.sam outfile # convert SAM to BAM (binary format)
scripts/makeBAMtracks.pl -i outfile.srt.bam --nodry # upload to genome browser
NOTE: make sure you use the RefSeq definition file that matches the RefSeq FASTA file you aligned to.
Remove duplicate reads from single-end alignments
Very often PCR amplification can generate an excessive amount of the same transcript. This interferes with the calculation of gene expression as well as the identification of mutations, so it is best to remove duplicates before performing such analyses. To remove duplicates for single-end reads, we retain the best N reads (according to average base quality scores) for each 5' alignment start position/strand. The latest implementation is much more memory efficient. It should take less than 5GB of RAM for 100 million unique alignments (Total=~ 125MB + 45MB per million unique alignments).
./geneModel rmdup2 -i accepted_hits.sam.gz -n 4 -o unique.sam # outputs an uncompressed sam file or ./geneModel rmdup2 -i accepted_hits.sam.gz -n 4 -o unique.sam.gz # directly outputs a gzipped sam file
Remove duplicate reads from paired-end alignments
The following command extracts reads that have both ends aligned to the reference genome and outputs all unaligned reads to another file (allreadsFile) if specified. Clonal read detection is based on the mapping coordinates in both RD1 and RD2; among the duplicate reads, only the one with the highest average Phred quality score is kept. Reads that aligned to multiple locations are discarded.
./geneModel rmdup -cmd paired -f1 $sam1 -f2 $sam2 -o1 $sam_unq1 -o2 $sam_unq2 -unaln ${allreadsFile} > $logfile
Note: this program detects both intra-chromosomal and inter-chromosomal duplicates.
Get read counts for a list of positions (or SNVs) from a sorted BAM file
./geneModel readcnt -cmd bam -snv snv_list.txt -bam alignment_hits.srt.bam [--uniq] -o SNVs_cnt.txt
options:
-snv file containing a list of positions
-bam alignment file in BAM format
-o output file
--uniq extract unique read counts (default= false)
snv list file format:
chr10 100479127
chr10 100479231
chr10 100479241
chr10 100480909
chr10 100495096
output file format: read count in the last column
chr10 100479127 2
chr10 100479231 3
chr10 100479241 4
chr10 100480909 4
chr10 100495096 3
Summarize gene expression levels from split SAM files (aligned against the hg18 genome)
./geneModel calcexp -sam split_dir/ -o output_file.exp [--unique]
options:
-sam directory
-o output expression summary file
--uniq report gene expression levels based on unique reads
output format:
chr gene name transcript utr5_cnt utr5_len coding_cnt coding_len utr3_cnt utr3_len total_cnt total_len
Extract unaligned read sequences
./geneModel ali -cmd unaln -aln output/accepted_hits.sam.gz -read data/s_1_sequence.txt > output/unaligned.fasta
options:
-aln alignment file
-read input fastq read sequence file
--fasta output unaligned reads in fasta format (default)
--fastq output unaligned reads in fastq format
Generate alignment statistics (e.g. # of clonal reads)
./geneModel sam -cmd sum -i alignments/rna001.sam.gz -o output/rna001_aln_summary.txt
Get read length from a SAM file
./geneModel align -cmd readlen -i sequences.fa
Convert from SAM format to ELAND
./geneModel sam2eland -i input -o output
Options:
-input Input SAM file
-output Output ELAND file (default= STDOUT)
Split a SAM file by chromosome
Split the alignments by chromosome for SNVseeqer or CHIPseeqer processing. This program can directly split compressed SAM files (*.sam.gz). The split files will be reads.chr* in the output directory.
./geneModel ali -cmd split -i my_sample.sam.gz -out split/ [ --fast ]
Options:
-i Input SAM file
-out Output directory containing the split SAM files
--fast Use this option if the input SAM file has not been coordinate sorted.
BAM related
Get read length from a BAM file
This program returns the length of the first encountered read in a BAM file.
./geneModel bam -cmd readlen
Options:
-i Input BAM file
-o Output file containing the read length
Calculate sequencing depth across the transcriptome
./geneModel bam -cmd depth -exon data/refGeneExons.txt -i alignments/sample.bam -o sample_seq_depth.txt
Options:
-i Input BAM file
-exon Exon regions (ChIP-seq format)
-o Output summary file
NOTE: the exon regions can be generated following the instruction here
Generate a read frequency Wiggle track from a BAM file
./geneModel bam -cmd wig -i output/accepted_hits.srt.bam -o output/read_cnt.wig [--uniq]
Options:
-i input BAM file
-o output Wiggle file
--uniq when specified removes the clonal reads when calculating the seq. depth
-hg specify what human genome release to use (hg18 or hg19)
Calculate RPKM expression values from a sorted BAM file
./geneModel calcexp -cmd bamrpkm -i alignments/rna001.srt.bam [--uniq] -o output_2011/rna001_rpkm.txt
Options:
-i input BAM file
-ref RefSeq gene definition file
--uniq use unique reads only (default= no)
-out output RPKM file
-hg specify what human genome relese to use (hg18 or hg19)
Convert your Wiggle file to BigWig format and upload it to the Web server
scripts/makeBigWig.pl -i output/read_cnt.wig -webdir relative_dir_on_your_server/ -title "Seq. depth" -desc "Read counts" --nodry
SNV related
Detect SNVs from a BAM file
- Call the SNVs from a sorted BAM file. This will also generate an SNV output file in SNVseeqer format (output_SNVsqr.txt)
./geneModel bam -cmd snv -i alignment/accepted_hits.bam -f ~/databases/hg18.fa --uniq -o SNVs.txt
Options:
-cmd snv Call SNVs from a BAM file. Here we assume a Poisson-Binomial model with
Benjamini Hochberg correction for multiple testing.
-i Input BAM file
-o Output SNV file (will also generate output_SNVsqr.txt in SNVseeqer format)
-f Reference genome (FASTA format)
-min Mininum number of supporting reads
-pval Threshold for adjust p-value (default: 0.01)
-test Type of statistical test for detecting SNVs:
1. Binomial test
2. Poisson-Binomial test
3. Perform both tests
-hg Specify the human genome release to use (hg18 or hg19)
-cpu Number of CPUs to use (default= 1)
--tmp Keep temporary files
--uniq Use unique alignments only (i.e. remove clonal reads)
-reg If specified, extract information and call SNVs for this region
Output file format:
chr1 168122 C 2684 144 143 1/0/141/1 7.94002e-286 8.342e-205 1.24322e-281
- chromosome
- position (0-based)
- Reference nucleotide
- Total number of reads
- Total number of unique reads
- Number of mutated reads
- Number of mutated reads on the plus strand
- Allele frequency for mutations (A/C/G/T)
- p-value by Binomial test
- p-value by Poisson-Binomial test
- Adjusted p-value (by default based on Poisson-Binomial)
NEW: bam-snv now supports multi-threading (multiple CPUs) and has a small memory footprint (e.g. <2GB total RAM using 5 threads for Exon-seq files from Illumina HiSeq2000).
Look up the base quality for a set of SNVs from a BAM file
./geneModel bam -cmd base-quality [options]
Options:
-i Input file containing the genomic coordinates
-bam BAM file
-f Reference genome in samtools-indexed FASTA format
-o Output file
--uniq Remove PCR duplicates
--keep Keep intermediate file
UCSC browser related
Rescale a Wiggle track by total number of bp aligned
./geneModel util -cmd rescale-wig -i density_track.wig -o density_track_norm.wig
Options:
-i input Wiggle track
-o output Wiggle track
-scale further multiply by this value (default: 1E9)
Normalize a Wiggle/BedGraph track so mean=0 and std=1
./geneModel util -cmd normalize-wig -i density_track.wig -o density_track_norm.wig
Generate a Wiggle/BedGraph track of the difference between two Wiggle/BedGraph files
./geneModel util -cmd diff-wig -f1 density_file1.wig -f2 density_file2.wig > output_density_diff_1_2.wig
Generate a Wiggle track of the RPKM gene expression values
The following command uses column 3 of the input file as RPKM values and produces a UCSC track, assuming column 0 contains the gene symbols. A value is provided for every 1000bp (non-overlapping) genomic window. If --smooth is specified, each window's reported value is the average raw value across 9 neighboring windows.
./geneModel dna -cmd rpkm-density -res 1000 [--smooth] -i data/rpkm_samples.txt -cidx 3 -o output/rpkm_sample2.wig
NOTE: this program can also be used to generate other types of tracks (e.g. copy number) as long as a value is provided for each gene.
Calculate gene density and generate a UCSC Wiggle track
./geneModel dna -cmd density -res 1000 [--smooth] -o output/gene_density_1kb_norm.wig
Options:
-res Resolution (size of a block)
-o Output wiggle file name
--smooth If specified, use the average of the neighboring 8 blocks (4 on each side)
Sequence related
Retrieve genes at the specified chromosomal position and show corresponding sequence products (mRNA, protein, exon id)
./geneModel dna2ref -chr chr6 -pos 170730963 locating chr6:170730963 loading databases/ucsc/refGene.txt.25Nov2009 Total: 31803 genes gene(s) found: NM_002598 NM_002598: strand= - start= 170728374 end= 170735673 name: PDCD2 mrna seq: TCTTGCCTTCCGGCCCGGCGCCCGATTTCCGCCTTCCGACCCAGCTGTGGGCTGCGCCC[...]GAATTAAATAAATTTTGGTACATCCACA coding seq: ATGGCTGCCGCCGGGGCCAGGCCTGTGGAGCTGGGCTTCGCCGAGTCGGCGCCGGCGTGGC[...]TAACAGATACACCGTAA coding length= 1035 protein seq: MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF[...]SCSLGTGYTEEFVWKQDVTDTP* length= 345 chr6:170730963 (0-based) refbase= T exon id: -1 runleft= -1 specified position not in exon or it's in a non-coding gene (exonid_cd == -1)
Transcribe a gene to mRNA from the genomic DNA sequence (hg18) based on refGene exon coordinates
./geneModel dna -cmd tr -gene NM_002598 --rna loading SNPseeqer/REFDATA/refGene.txt.25Nov2009 >NM_002598 TCTTGCCTTCCGGCCCGGCGCCCGA[...]GACAGATTGCTTACACAGTGTCTACTTATTAGTGAAACAAAAGTGTCCAGTGACAGGGAATTAAATAAATTTTGGTACATCCACA
Translate a gene to its protein sequence based on refGene exon coordinates
./geneModel dna -cmd tr -gene NM_002598 loading SNPseeqer/REFDATA/refGene.txt.25Nov2009 >NP_002589 NM_002598 MAAAGARPVELGFAESAPAWRLRSEQ[...]EKDIPDCPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP*
Get all sequence lengths from a FASTA file
./geneModel dna -cmd len -i sequences.fa
DNA sequence [reverse] and/or [complement]
./geneModel dna -seq ctggtctcgaactcctgagctcaag input: ctggtctcgaactcctgagctcaag complement: GACCAGAGCTTGAGGACTCGAGTTC reverse: gaactcgagtcctcaagctctggtc rev. compl: CTTGAGCTCAGGAGTTCGAGACCAG length: 25
Retrieve a genomic region from hg18 genome
./geneModel hg18 -reg chr5:135,540,630-135,540,639 --upper TACTGTACTG length= 10
Convert a FASTQ file to FASTA format (after quality filtering)
./geneModel seq -cmd conv2fasta -i fastq_sequence.txt.gz -o output_fasta.txt [-minq 15.0]
options:
-i input FASTQ file (txt or compressed)
-o output FASTA file (STDOUT if not specified)
-minq minimum average Phred score for quality filtering
example output:
total: 18809829 reads
passed: 18319274 reads
quality filter: 15
Gene related
Extracting all exonic regions from the genome
./geneModel dna -ref refGene.txt -o refGene_exons.txt
Options:
-ref RefSeq definition file
-o Output file
NOTE: The (non-overlapping) exon regions will be in ChIP-seq format.
Get gene transcript structure
./geneModel dna -cmd struct -name NM_001134738 output: NM_001134738: BCL6 chr3 strand: - tx start: 188921858 cd start: 188922939 Exon 0: 188921858 - 188923083 Exon 1: 188925422 - 188925560 ... Exon 6: 188934014 - 188934185 Exon 7: 188935350 - 188935389 cd end: 188934175 tx end: 188935389
Convert gene identifiers
E.g. The following specifies that column 0 of the input file contains RefSeq transcript identifiers and adds a column of corresponding gene symbols. ./geneModel util -cmd convert-gene-id -i input_file.txt -cidx 0 --transcript > output_file.txt
Convert gene identifiers (advanced)
You can also convert identifiers in more than one column and between your choice of identifiers (UCSC, RefSeq, gene symbol). The following example converts the UCSC gene ids in columns 4 and 6 to gene symbols. This is done by fist using the convert-gene-id command on column 4 and feeding the intermediate output (through the pipe "|") to another convert-gene-id command which converts column 6.
There are seven types of conversion you can do:
- 0: RefSeq -> Gene
- 1: UCSC -> Gene
- 2: Gene -> RefSeq
- 3: Gene -> UCSC
- 4: Gene -> Chr
- 5: RefSeq -> Chr
- 6: Gene -> ChIP-seq style interval
- 7: RefSeq -> ChIP-seq style interval
E.g.
./geneModel util -cmd convert-gene-id -i input_file.txt -cid 4 -type 1 --uniq | ./geneModel util -cmd convert-gene-id -cid 6 -type 1 --uniq > final_output.txt
Here is a complete list of options:
-i Input file
-cid Column index of the query identifiers
-sep Field separator
-type Type of conversion to perform:
0: RefSeq -> Gene
1: UCSC -> Gene
2: Gene -> RefSeq
3: Gene -> UCSC
4: Gene -> Chr
5: RefSeq -> Chr
6: Gene -> ChIP-seq style interval
7: RefSeq -> ChIP-seq style interval
-chip ChIP-seq style interval file; required if type is 6 or 7
--range If type is 4 or 5 (above), then also output the start and end position of the gene
--uniq
--trans Identifier is RefSeq transcript id (kpet for backward compability)
Process the duplicate records in the RefSeq definition file
There are occasionally RefSeq transcripts with identical ids assigned to disparate locations in the genome. We may handle such cases by regenerating a RefSeq definition file with unique identifiers along with their corresponding FASTA sequences. By default (without the --first option) a numerical suffix will be added to each duplicate transcript id so each will later generate its own sequence. On the other hand, the --first option, when specified, will keep each of the first encountered transcript records and ignore all other duplicate ids. Note that transcripts on haplotype and random chromosomes are filtered out.
./geneModel dna -cmd uniq-refseq -ref RefGene.txt -o RefGene_uniq.txt [--first]
-ref RefSeq definition file
-o Output unique definition file
--first If specified, only output the first qualifying record for duplicate transcript ids
NOTE: To generate the reference FASTA sequences from the unique RefSeq definition file, please use rebuildRefSeqFromRefGene following instructions in SNVseeqer database tools
Create data file for PAGE analysis
PAGE (Pathway Analysis of Gene Expression) is a program that identifies the enrichment of Gene Ontology or KEGG pathways from a list of user provided genes. You can easily create the PAGE input file from your list of genes using the following command. Read more about PAGE here.
./geneModel page -i input_genes.txt -o page_file.txt
NOTE: input_genes.txt contains genes that you believe are associated through some up-stream analysis (e.g. microarray co-expression analysis). It contains only one column, e.g.
ACTA2 ACTL7A ACTL7B ACTR1A ...
ChIP-seq peaks related
Find overlap between two sets of peaks
./geneModel peakoverlap [options]
options:
-i peak file 1
-j peak file 2; will be used as reference in the output file
-o Output peak file
-l Log file
-exti Extend peaks in file 1 by exti bp on each side
-extj Extend peaks in file 2 by exti bp on each side
--new Only output the overlapping peak regions (i.e. without regions in peak file 2)
--ref If both --new and --ref are specified, output the reference peaks in file 2
(instead of the overlapping regions) that overlap with any peak in file 1
--diff If specified, show only the file2 peaks that do not overlap with any peaks in file1
Merge multiple sets of peaks
This program merges multiple sets of overlapping peaks (within and across input files) and generates a set of non-overlapping peaks.
./geneModel chip -cmd union -f file1.txt -f file2.txt -f file3.txt [-f ....] -o outfile.txt
options:
-f ChIP-seq file. Multiple files can be specified using multiple -f arguments, e.g.
-cmd union -f file1.txt -f file2.txt -f file3.txt
-o Output ChIP-seq file with the merged peaks
Example peaks:
File A:
<----------> <--------->
File B:
<-----> <------>
File C:
<------> <-------->
Output:
<----------------------------> <-------->
Annotate ChIP-seq peaks with gene information
./geneModel chip -cmd annotate-peaks [--gene] [--original] -i chip_seq_file.txt -o chip_seq_gene.txt
Options:
--gene if specified, output in gene centric view; shows for each gene the number of peaks in the promoter, gene body, and distal region.
--original show original peaks (and annotations)
Annotate one set of intervals with a reference set of intervals
This program annotates one set of intervals with a reference set of intervals. For example, for each query TF binding site, we can find out which cytoband it belongs to and then summarize/filter by the number of TF binding sites each cytoband contains.
E.g. the following command finds cytobands that have at least 5 BCL6 binding sites.
./geneModel util -cmd map-intervals -i data/BCL6_targets.txt -chip data/cytoband_positions.txt --filter -min 5
Usage: ./geneModel chip -cmd map-intervals [options]
Options:
-i File containing intervals to be annotated
-chip Reference set of ChIP-seq style intervals
-out Output file containing the annotations
--filter Filter based on the number of query intervals in each reference interval
-min Minimum number of query intervals in each reference interval
-offset If specified, the right end of each interval will be offset by this
value (default=1). This option is used to deal with cases where the
right side of the interval is 1-based.
Get distances to TSSs or TESs
./geneModel chip -cmd dist2tss [options]
Options:
-i input ChIP-seq file
-maxdist max. distance to a TSS/TES allowed
-cutoff how far should we look downstream of a TSS or upstream of a TES?
--tes use TESs instead of TSSs
--orig include original data in the output file
Calculate the density of ChIP-seq binding sites around specified positions
./geneModel chip -cmd cal-density [options]
-i Query file containing the query positions in ChIP-seq format (use - to indicate STDIN).
-chip Reference ChIP-seq file.
-o Output file.
-max Maximum distance to each query position. We search for ChIP-seq peaks in this neighborhood.
-sep Field separator used when parsing the query file.
--orig Show original columns in input file. If not specified, show only the peak intervals and density.
Generate a binary wiggle file at the specified resolution for fast lookup
./geneModel chip -cmd bin-wig [options]
-i Input Wiggle track
-o Output binary Wiggle file
-res Resolution (bin size)
Print the content of a binary wiggle file
./geneModel chip -cmd print-bin-wig [options]
-i Binary wiggle file
Extend the peak intervals by n-bp on each side
./geneModel chip -cmd extendpeaks [options]
-i Input ChIP-seq style interval file
-n Number of basepairs to extend on each side of a peak
-o Output file of extended peaks
Map frequency data to ChIP-seq intervals
./geneModel -cmd wiggle2chip [options]
-i Wiggle file. The file can be in text (.wig) or binary (.wigbin) format.
-chip ChIP-seq style interval file (query)
-o Output file
-res Resolution at which the frequency data is loaded into memory.
--peak Treat each line in the input wiggle file as a binary peak. I.e. this ignores the peak height and width
-scale Rescale the output frequency
0: do not rescale the frequency (default)
1: rescale the frequency by the size of the query interval
2: rescale the frequency by the number of bins that overlap with the query interval
This is used to find the average frequency from bins that overlap with the query interval.
--normbin Normalize the output frequency by bin size.
--interval If specified, output only the interval followed by the frequency.
Everything else in the original ChIP-seq file is ignored in the output.
Generate files for differential FIRE analysis
./geneModel -cmd dfire [options]
-f Files (use -f file1 -f file2 -f file3 ...)
-t Tags (use -t tag1 -t tag2 -t tag3 ...)
-ref Reference human genome (samtools-indexed)
-o Output file base (will append .FIRE.txt and .FIRE.seq)
Network related analyses
Output the degrees and annotations of genes in the network
./geneModel network -cmd degree -i network.sif -o output.txt
Options:
-i input SIF file
-o output file
Extract the N most connected genes (hubs) and perform PAGE pathway enrichment analysis
./geneModel network -cmd page -i network.sif -o output.txt -n topN
Options:
-i input SIF file
-o output PAGE file
-n top N hubs
Find connected sub-networks and output their component genes
./geneModel network -cmd subnet -i network.sif -o output.txt -n topN [--split]
Options:
-i input SIF file
--split if a node contains multiple gene names (e.g. "A1CF|GFER"), split the node according to the separator
-sep separator (default="|")
-o output file
Other functions
Perform Fisher's exact tests
This command performs Fisher's exact test on each line of the input file using data in the specified columns (-fields option). The four columns' values (a,b,c,d) are defined following the convention below (group x observation). Three columns will be appended to each line showing p-value(two.sides), p-value(greater) and p-value(less). Note that here we only deal with 2x2 contingency tables.
| G1 | G2 -----+-----+------ obs1 | a | b -----+-----+------ obs2 | c | d
./geneModel util -cmd fisher -i my_counts.txt -fields 1,2,3,4 -o outfile_pval.txt
Perform Benjamini–Hochberg correction for multiple hypothesis testing
This command performs Benjamini–Hochberg correction on the p-values in the specified column of the input file.
./geneModel util -cmd bh-correction -i infile_pval.txt -col 7 -o outfile_padj.txt
Additional options:
-pval output only records with adjusted p-values less than this threadshold
--small use small memory algorithm
Calculate the histogram based on the input column(s) of a file
E.g. Use data in columns 7 and 8 of input_file.txt.gz and calculate the histogram with min=0, max=15000, and bin size=25. ./geneModel util -cmd cal-histogram -i input_file.txt.gz -min 0 -max 15000 -bin 25 -cidx 7,8 -o output_histogram.txt
Merge rows of the same key and output the averaged values per specified column per key
E.g. Use column 6 (gene symbol) of input_file.txt as key and output averaged values for columns 1,2,3,4. ./geneModel util -cmd merge-row-val -i input_file.txt -kidx 6 -vidx 1,2,3,4 > merged.txt input_file.txt NM_001042697 28.1 38.9 17.6 10.2 9.7 ZSWIM7 NM_001042698 28.9 39.2 18.6 11.3 10.9 ZSWIM7 merged.txt ZSWIM7 28.5 39.05 18.1 10.75
Find the intersection between two lists of items
./geneModel util -cmd list-overlap -f1 list1.txt -f2 list2.txt [--print] options: use -idx1 and -idx2 to specify which columns in the files the items are in (default=0).
Find the difference between two lists of items (set2 - set1)
./geneModel util -cmd list-overlap -f1 list1.txt -f2 list2.txt --diff [--print] options: use -idx1 and -idx2 to specify which columns in the file the items are in (default=0).
Filtering: compare column(s) of a file to a reference list
Print records whose specified columns contain any of the items provided in the master list/reference file.
./geneModel util -cmd filter-from-list
Options:
-i Input file
-tgidx Column indices in the input (target) file (comma-separated)
-list Master list/reference file
-lidx Column index in the list file
-match Tag to show when the query columns are in the list file. if not specified, the matching key will be shown
--showall If specified, show all lines whether or not the query columns match the list file
Find the overlap between two files based on multiple columns
This can be used when the key (e.g. chromosomal region) is split into several fields (e.g. chr, start pos, end pos). Lines in file2 with keys that already appeared in file1 will be output.
E.g. the following command prints out the lines in file2.txt whose columns 0,1,2 appear in file1.txt. ./geneModel util -cmd file-overlap -f1 file1.txt -f2 file2.txt -idx1 0,1,2 -idx2 0,1,2 > output_file
Find the difference between two files based on multiple columns
This can be used when the key (e.g. chromosomal region) is split into several fields (e.g. chr, start pos, end pos). Lines in file2 with keys not seen in file1 will be output.
E.g. the following command prints out the lines in file2.txt whose columns 0,1,2 are not in file1.txt. ./geneModel util -cmd file-difference -f1 file1.txt -f2 file2.txt -idx1 0,1,2 -idx2 0,1,2 > output_file
Add columns from a reference file to a query input file
./geneModel util -cmd add-columns -i input_file
-cmd add-columns Add columns from a reference data file to the input file after matching gene names
-i Input file
-dat Reference data file.
-key Column index of the key in the input file
-ref Column index of the key in the reference data file
-val Column indices of the values to extract
-na Tag for genes without matching data in the reference file
Extract columns from multiple files and merge by key (row)
E.g. Here we have three files containing gene expression values from four microarray (exp_array.txt) and RNA-seq experiments (rna001_rpkm.txt and rna002_rpkm.txt). We want to merge these files and output all four expression values for every gene. Let's say the input files have the following format:
exp_array.txt:
(format: gene, expression in exp1, expression in exp2) AAA 8.305 5.506
rna001_rpkm.txt:
(format: gene, transcript, total length of exons, number of reads, rpkm) AAA NM_XXX 9342 4653 3.17929
and rna002_rpkm.txt:
(format: gene, transcript, total length of exons, number of reads, rpkm) AAA NM_XXX 918 4188 0.339037
We can then extract the gene expression values by specifying the columns where the keys (genes) and expression values are using:
./geneModel util -cmd merge-col -f output/exp_array.txt -f output/exp_array.txt -f output/rna001_rpkm.txt -f output/rna002_rpkm.txt \
-key 0,0,0,0 -val 1,2,4,4 -o output/exp_RNAseq_array.txt
Additional option:
-missing what to print when a key does not exist in the input file (default= "")
The output will be something like:
AAA 8.305 5.506 3.17929 0.339037
Convert numerical chr ids (1..24) to string chr ids (chr1..chrY) in the specified column of a file
./geneModel util -cmd convert-num -i file.txt -col 0
-i Input file
-o Output file
-d Delimiter
-col Column index (0-based)
If input file name is empty, the program reads in the data stream from STDIN.
Displaying all commands
./geneModel help all
Utility scripts
Generate SGE script files from a command file (one SGE file per command line)
To generate SGE scripts (e.g. qHiC2011_0.sh) from a file containing one command per line:
scripts/makeSGEjob_per_line.pl -input batchHic2011.sh -sge qHiC2011 -wall 5:00:00
To submit the SGE jobs, use:
for i in `ls qHiC2011_*.sh`; do qsub $i; done
Options for makeSGEjob_per_line.pl:
-input input file containing command lines -sge output SGE script file base name -wall wall time -inst additional instructions for the SGE scheduler (e.g. -q to specify the platform) --submit submit the jobs to the SGE immediately after generating the scripts --array generate scripts that run in ARRAY JOB MODE
NOTE:
- makeSGEjob_per_line.pl takes input from STDIN so you can use it to directly start a job.
E.g. The following command starts a BLAT server that runs 36 hours:
echo "gfServer start localhost XXXX -stepSize=5 -log=untrans.log ~/databases/wg/hg18.fa.2bit " | ./makeSGEjob_per_line.pl -input - -sge qBLAT_server -mem 5g -wall 36:00:00 --log --submit
