GeneTools

From Icbwiki

Revision as of 15:28, 29 November 2011; view current revision
←Older revision | Newer revision→
Jump to: navigation, search

Contents

geneTools

Related pages

NGS Pipeline

This program generates scripts for pre-processing reads, performing QC analysis, doing sequence alignment (TopHat, BWA), visualization, etc.

scripts/pipelineSeq.pl

Example 1

Assuming raw sequences were generated by Illumina Casava 1.8 and are stored in those big TAR files. After untarring them the reads are stored in Sample_name_R1_*.fastq.gz in data/Sample_*/ subdirectories. The following commands will:

  • Filter the raw reads by Illumina pass-filter tags and base quality.
  • Run BWA to align all these split small FASTQ files in parallel.
  • Convert the output SAM file to BAM format.
  • Split the SAM alignments by chromosome for SNVseeqer/CHIPseeqer.
  • Generate raw/unique read frequency files.
  • Generate wiggle tracks for visualization on the UCSC genome browser.
# Generate lists containing files to process
for i in `ls -d data/Sample_*/` ; do
       outfile=${i}/seq_files.list
       ls $i/*.fastq.gz > $outfile
done

# Generate and submit scripts 
for i in `ls -d data/Sample_*`; do
       samplename=`basename $i`
       ./pipelineSeq.pl -list data/${samplename}/seq_files.list -mem 3g -time 5:00:00 -type chip -webdir tmp_web_output \
                       --filter -out alignments_chip/$samplename --casava18 -tag $samplename
       # submit Sun Grid Engine jobs 
       qsub qALN_CHIP_${samplename}.sh
       qsub -h qALN_CHIP_${samplename}_post.sh
       qalter -hold_jid qALN_CHIP_${samplename}.sh qALN_CHIP_${samplename}_post.sh
       qalter -h U qALN_CHIP_${samplename}_post.sh
done

Processing FASTQ files

Filter and trim single-end reads

The following command keeps the nucleotides in positions 0-24 (total length of 25 bp) and filters out trimmed reads that have low quality (average score < 30.0).

./geneModel seq -cmd trimse -f data/sample_1_sequence.txt.gz -s 0 -len 25 -minscore 30.0 -o output/trimmed_sample_1_sequence.txt.gz
Options:
               -f               FASTQ file
               -o               Output FASTQ file
               -start           Starting read position (0-based)
               -len             Output read length
               -minscore        Minimum average quality score in each trimmed read (default: 30.0)
               --casava18       Indicate that the file is in CASAVA 1.8 format
               --PF             If input file is in CASAVA 1.8 format, further filter based on the Pass Filter tag

Filter and trim paired-end reads

The following command keeps the nucleotides in positions 0-24 (total length of 25 bp) and filters out trimmed reads that have low quality (either end with average score < 30.0). The read identifiers are output in the same order in the resulting RD1 and RD2 files.

./geneModel seq -cmd trimpe -f1 data/sample_1_sequence.txt.gz -f2 data/sample_2_sequence.txt.gz -s 0 -len 25 -minscore 30.0 
                            -o1 output/trimmed_sample_1_sequence.txt.gz -o2 output/trimmed_sample_2_sequence.txt.gz
Options:
               -f1              FASTQ file 1
               -f2              FASTQ file 2
               -o1              Output FASTQ file 1
               -o2              Output FASTQ file 2
               -start           Starting read position (0-based)
               -len             Output read length
               -minscore        Minimum average quality score in each trimmed read (default: 30.0)
               --casava18       Indicate that the files are in CASAVA 1.8 format
               --PF             If input files are in CASAVA 1.8 format, further filter based on the Pass Filter tag

Display numerical Phred score values

The following command converts the ASCII Phred codes to their numerical values.

./geneModel phred -seq 'be^eb]^^Ueef^fZabSbaag[QgdadbffdbG]YIXO[`]edb_f_T^Xe_ecbfeebcf\ffcfdff_BBBB'

Estimate insert size from paired-end reads

scripts/getInsertSize.pl estimates the average insert size from paired-end reads (FASTQ format). Insert size is defined as total selected fragment size - 2 * read length unless --total is specified.

Options:
       -i       FASTQ file for RD1
       -j       FASTQ file for RD2
       -o       Output file containing all insert sizes for all reads (optional)
       -log     Output file containing mean and median insert sizes
       -ref     Reference genome sequences
       --total  Report as insert size the average total length of the selected fragments (i.e. between the start
                coordinate of the left read in the read-pair and the end coordinate of the right read in the read-pair)
       -help

NOTE:

  • To run this program you need the bowtie aligner, a reference human genome, and its bowtie indices.

Alignment/SAM related

Convert RefSeq-based alignments to genome-based alignments

./geneModel align -cmd ref2g -i bwa_ref.sam -o bwa_genome.sam
Options:
                -i    input sam file
                -o    output sam file
                -ref  RefSeq data file

scripts/quickSAM2BAM.pl bwa_genome.sam outfile                     # convert SAM to BAM (binary format)
scripts/makeBAMtracks.pl -i outfile.srt.bam --nodry                # upload to genome browser

NOTE: make sure you use the RefSeq definition file that matches the RefSeq FASTA file you aligned to.

Remove duplicate reads from single-end alignments

Very often PCR amplification can generate an excessive amount of the same transcript. This interferes with the calculation of gene expression as well as the identification of mutations, so it is best to remove duplicates before performing such analyses. To remove duplicates for single-end reads, we retain the best N reads (according to average base quality scores) for each 5' alignment start position/strand. The latest implementation is much more memory efficient. It should take less than 5GB of RAM for 100 million unique alignments (Total=~ 125MB + 45MB per million unique alignments).

./geneModel rmdup2 -i accepted_hits.sam.gz -n 4 -o unique.sam            # outputs an uncompressed sam file
 or 
./geneModel rmdup2 -i accepted_hits.sam.gz -n 4 -o unique.sam.gz         # directly outputs a gzipped sam file

Remove duplicate reads from paired-end alignments

The following command extracts reads that have both ends aligned to the reference genome and outputs all unaligned reads to another file (allreadsFile) if specified. Clonal read detection is based on the mapping coordinates in both RD1 and RD2; among the duplicate reads, only the one with the highest average Phred quality score is kept. Reads that aligned to multiple locations are discarded.

./geneModel rmdup -cmd paired -f1 $sam1 -f2 $sam2 -o1 $sam_unq1 -o2 $sam_unq2 -unaln ${allreadsFile} > $logfile

Note: this program detects both intra-chromosomal and inter-chromosomal duplicates.

Get read counts for a list of positions (or SNVs) from a sorted BAM file

./geneModel readcnt -cmd bam -snv snv_list.txt -bam alignment_hits.srt.bam [--uniq] -o SNVs_cnt.txt
options:
                -snv    file containing a list of positions
                -bam    alignment file in BAM format
                -o      output file 
                --uniq  extract unique read counts (default= false)

snv list file format:
chr10   100479127
chr10   100479231
chr10   100479241
chr10   100480909
chr10   100495096

output file format: read count in the last column
chr10   100479127       2
chr10   100479231       3 
chr10   100479241       4
chr10   100480909       4 
chr10   100495096       3

Summarize gene expression levels from split SAM files (aligned against the hg18 genome)

./geneModel calcexp -sam split_dir/ -o output_file.exp [--unique]
options:
                -sam                 directory 
                -o                   output expression summary file
                --uniq               report gene expression levels based on unique reads       

output format: 
chr   gene name       transcript      utr5_cnt        utr5_len        coding_cnt      coding_len      utr3_cnt        utr3_len        total_cnt       total_len

Extract unaligned read sequences

./geneModel ali -cmd unaln -aln output/accepted_hits.sam.gz -read data/s_1_sequence.txt  > output/unaligned.fasta
options:
               -aln             alignment file
               -read            input fastq read sequence file
               --fasta          output unaligned reads in fasta format (default)
               --fastq          output unaligned reads in fastq format

Generate alignment statistics (e.g. # of clonal reads)

./geneModel sam -cmd sum -i alignments/rna001.sam.gz -o output/rna001_aln_summary.txt

Get read length from a SAM file

./geneModel align -cmd readlen -i sequences.fa

Convert from SAM format to ELAND

./geneModel sam2eland -i input -o output
Options:
               -input           Input SAM file
               -output          Output ELAND file (default= STDOUT)

Split a SAM file by chromosome

Split the alignments by chromosome for SNVseeqer or CHIPseeqer processing. This program can directly split compressed SAM files (*.sam.gz). The split files will be reads.chr* in the output directory.

./geneModel ali -cmd split -i my_sample.sam.gz -out split/ [ --fast ]

Options:
               -i               Input SAM file
               -out             Output directory containing the split SAM files
               --fast           Use this option if the input SAM file has not been coordinate sorted.

BAM related

Get read length from a BAM file

This program returns the length of the first encountered read in a BAM file.

./geneModel bam -cmd readlen         
Options: 
               -i               Input BAM file
               -o               Output file containing the read length

Calculate sequencing depth across the transcriptome

./geneModel bam -cmd depth -exon data/refGeneExons.txt -i alignments/sample.bam -o sample_seq_depth.txt
Options:
               -i               Input BAM file
               -exon            Exon regions (ChIP-seq format)
               -o               Output summary file

NOTE: the exon regions can be generated following the instruction here

Generate a read frequency Wiggle track from a BAM file

./geneModel bam -cmd wig -i output/accepted_hits.srt.bam -o output/read_cnt.wig [--uniq]
Options:
                -i     input BAM file
                -o     output Wiggle file
                --uniq when specified removes the clonal reads when calculating the seq. depth
                -hg    specify what human genome release to use (hg18 or hg19)

Calculate RPKM expression values from a sorted BAM file

./geneModel calcexp -cmd bamrpkm -i alignments/rna001.srt.bam [--uniq] -o output_2011/rna001_rpkm.txt
Options:
               -i               input BAM file
               -ref             RefSeq gene definition file
               --uniq           use unique reads only (default= no)
               -out             output RPKM file
               -hg              specify what human genome relese to use (hg18 or hg19)

Convert your Wiggle file to BigWig format and upload it to the Web server

scripts/makeBigWig.pl -i output/read_cnt.wig -webdir relative_dir_on_your_server/ -title "Seq. depth" -desc "Read counts" --nodry

SNV related

Detect SNVs from a BAM file

  • Call the SNVs from a sorted BAM file. This will also generate an SNV output file in SNVseeqer format (output_SNVsqr.txt)
./geneModel bam -cmd snv -i alignment/accepted_hits.bam -f ~/databases/hg18.fa --uniq -o SNVs.txt
Options:
          -cmd snv              Call SNVs from a BAM file. Here we assume a Poisson-Binomial model with
                                Benjamini Hochberg correction for multiple testing.
               -i               Input BAM file
               -o               Output SNV file (will also generate output_SNVsqr.txt in SNVseeqer format)
               -f               Reference genome (FASTA format)
               -min             Mininum number of supporting reads
               -pval            Threshold for adjust p-value (default: 0.01)
               -test            Type of statistical test for detecting SNVs:
                                   1. Binomial test
                                   2. Poisson-Binomial test
                                   3. Perform both tests
               -hg              Specify the human genome release to use (hg18 or hg19)
               -cpu             Number of CPUs to use (default= 1)
               --tmp            Keep temporary files
               --uniq           Use unique alignments only (i.e. remove clonal reads)
               -reg             If specified, extract information and call SNVs for this region

Output file format:

chr1    168122        C       2684            144          143     1/0/141/1       7.94002e-286    8.342e-205      1.24322e-281
  1. chromosome
  2. position (0-based)
  3. Reference nucleotide
  4. Total number of reads
  5. Total number of unique reads
  6. Number of mutated reads
  7. Number of mutated reads on the plus strand
  8. Allele frequency for mutations (A/C/G/T)
  9. p-value by Binomial test
  10. p-value by Poisson-Binomial test
  11. Adjusted p-value (by default based on Poisson-Binomial)

NEW: bam-snv now supports multi-threading (multiple CPUs) and has a small memory footprint (e.g. <2GB total RAM using 5 threads for Exon-seq files from Illumina HiSeq2000).

UCSC browser related

Rescale a Wiggle track by total number of bp aligned

./geneModel util -cmd rescale-wig -i density_track.wig -o density_track_norm.wig
Options:
                -i              input Wiggle track
                -o              output Wiggle track
                -scale          further multiply by this value (default: 1E9)

Normalize a Wiggle/BedGraph track so mean=0 and std=1

./geneModel util -cmd normalize-wig -i density_track.wig -o density_track_norm.wig

Generate a Wiggle/BedGraph track of the difference between two Wiggle/BedGraph files

./geneModel util -cmd diff-wig -f1 density_file1.wig -f2 density_file2.wig > output_density_diff_1_2.wig

Generate a Wiggle track of the RPKM gene expression values

The following command uses column 3 of the input file as RPKM values and produces a UCSC track, assuming column 0 contains the gene symbols. A value is provided for every 1000bp (non-overlapping) genomic window. If --smooth is specified, each window's reported value is the average raw value across 9 neighboring windows.

./geneModel dna -cmd rpkm-density -res 1000 [--smooth]  -i data/rpkm_samples.txt -cidx 3 -o output/rpkm_sample2.wig

NOTE: this program can also be used to generate other types of tracks (e.g. copy number) as long as a value is provided for each gene.

Calculate gene density and generate a UCSC Wiggle track

./geneModel dna -cmd density -res 1000 [--smooth] -o output/gene_density_1kb_norm.wig 
Options:
               -res             Resolution (size of a block)
               -o               Output wiggle file name
               --smooth         If specified, use the average of the neighboring 8 blocks (4 on each side)

Sequence related

Retrieve genes at the specified chromosomal position and show corresponding sequence products (mRNA, protein, exon id)

./geneModel dna2ref -chr chr6 -pos 170730963

locating chr6:170730963
loading databases/ucsc/refGene.txt.25Nov2009
Total: 31803 genes
gene(s) found: NM_002598
NM_002598: strand= - start= 170728374 end= 170735673
name: PDCD2
mrna seq:
TCTTGCCTTCCGGCCCGGCGCCCGATTTCCGCCTTCCGACCCAGCTGTGGGCTGCGCCC[...]GAATTAAATAAATTTTGGTACATCCACA
coding seq:
ATGGCTGCCGCCGGGGCCAGGCCTGTGGAGCTGGGCTTCGCCGAGTCGGCGCCGGCGTGGC[...]TAACAGATACACCGTAA
coding length= 1035
protein seq:
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF[...]SCSLGTGYTEEFVWKQDVTDTP* 
length= 345
chr6:170730963 (0-based) refbase= T exon id: -1 runleft= -1
specified position not in exon or it's in a non-coding gene (exonid_cd == -1)

Transcribe a gene to mRNA from the genomic DNA sequence (hg18) based on refGene exon coordinates

./geneModel dna -cmd tr -gene NM_002598  --rna
loading SNPseeqer/REFDATA/refGene.txt.25Nov2009
>NM_002598
TCTTGCCTTCCGGCCCGGCGCCCGA[...]GACAGATTGCTTACACAGTGTCTACTTATTAGTGAAACAAAAGTGTCCAGTGACAGGGAATTAAATAAATTTTGGTACATCCACA

Translate a gene to its protein sequence based on refGene exon coordinates

./geneModel dna -cmd tr -gene NM_002598 
loading SNPseeqer/REFDATA/refGene.txt.25Nov2009
>NP_002589 NM_002598
MAAAGARPVELGFAESAPAWRLRSEQ[...]EKDIPDCPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP*

Get all sequence lengths from a FASTA file

./geneModel dna -cmd len -i sequences.fa

DNA sequence [reverse] and/or [complement]

./geneModel dna -seq ctggtctcgaactcctgagctcaag
input:      ctggtctcgaactcctgagctcaag
complement: GACCAGAGCTTGAGGACTCGAGTTC
reverse:    gaactcgagtcctcaagctctggtc
rev. compl: CTTGAGCTCAGGAGTTCGAGACCAG
length:     25

Retrieve a genomic region from hg18 genome

./geneModel hg18 -reg chr5:135,540,630-135,540,639 --upper
TACTGTACTG
length= 10

Convert a FASTQ file to FASTA format (after quality filtering)

./geneModel seq -cmd conv2fasta -i fastq_sequence.txt.gz -o output_fasta.txt [-minq 15.0]
options:
                -i    input FASTQ file (txt or compressed)
                -o    output FASTA file (STDOUT if not specified)
                -minq minimum average Phred score for quality filtering

example output:
total: 18809829 reads
passed: 18319274 reads 
quality filter: 15

Gene related

Extracting all exonic regions from the genome

./geneModel dna -ref refGene.txt -o refGene_exons.txt
Options:
               -ref             RefSeq definition file
               -o               Output file

NOTE: The (non-overlapping) exon regions will be in ChIP-seq format.

Get gene transcript structure

./geneModel dna -cmd struct -name NM_001134738

output:
NM_001134738: BCL6
chr3
strand: -
tx start: 188921858
cd start: 188922939
Exon 0: 188921858 - 188923083
Exon 1: 188925422 - 188925560
...
Exon 6: 188934014 - 188934185
Exon 7: 188935350 - 188935389
cd end: 188934175
tx end: 188935389

Convert gene identifiers

E.g. The following specifies that column 0 of the input file contains RefSeq transcript identifiers and adds a column of corresponding gene symbols.

./geneModel util -cmd convert-gene-id -i input_file.txt -cidx 0 --transcript > output_file.txt

Convert gene identifiers (advanced)

You can also convert identifiers in more than one column and between your choice of identifiers (UCSC, RefSeq, gene symbol). The following example converts the UCSC gene ids in columns 4 and 6 to gene symbols. This is done by fist using the convert-gene-id command on column 4 and feeding the intermediate output (through the pipe "|") to another convert-gene-id command which converts column 6.

There are four types of conversion you can do:

  • 0: RefSeq -> Gene
  • 1: UCSC -> Gene
  • 2: Gene -> RefSeq
  • 3: Gene -> UCSC
./geneModel util -cmd convert-gene-id -i input_file.txt -cid 4 -type 1 --uniq | ./geneModel util -cmd convert-gene-id -cid 6 -type 1 --uniq > final_output.txt

Process the duplicate records in the RefSeq definition file

There are occasionally RefSeq transcripts with identical ids assigned to disparate locations in the genome. We may handle such cases by regenerating a RefSeq definition file with unique identifiers along with their corresponding FASTA sequences. By default (without the --first option) a numerical suffix will be added to each duplicate transcript id so each will later generate its own sequence. On the other hand, the --first option, when specified, will keep each of the first encountered transcript records and ignore all other duplicate ids. Note that transcripts on haplotype and random chromosomes are filtered out.

./geneModel dna -cmd uniq-refseq -ref RefGene.txt -o RefGene_uniq.txt [--first]
               -ref             RefSeq definition file
               -o               Output unique definition file
               --first          If specified, only output the first qualifying record for duplicate transcript ids

NOTE: To generate the reference FASTA sequences from the unique RefSeq definition file, please use rebuildRefSeqFromRefGene following instructions in SNVseeqer database tools

Create data file for PAGE analysis

PAGE (Pathway Analysis of Gene Expression) is a program that identifies the enrichment of Gene Ontology or KEGG pathways from a list of user provided genes. You can easily create the PAGE input file from your list of genes using the following command. Read more about PAGE here.

./geneModel page -i input_genes.txt -o page_file.txt

NOTE: input_genes.txt contains genes that you believe are associated through some up-stream analysis (e.g. microarray co-expression analysis). It contains only one column, e.g.

ACTA2
ACTL7A
ACTL7B
ACTR1A 
...

ChIP-seq peaks related

Find overlap between two sets of peaks

./geneModel peakoverlap [options]
options:
               -i               peak file 1
               -j               peak file 2; will be used as reference in the output file
               --new            output the overlapping peak regions (i.e. without regions in peak file 2)

Merge multiple sets of peaks

This program merges multiple sets of overlapping peaks (within and across input files) and generates a set of non-overlapping peaks.

./geneModel chip -cmd union -f file1.txt -f file2.txt -f file3.txt [-f ....] -o outfile.txt
options:
                 -f             ChIP-seq file. Multiple files can be specified using multiple -f arguments, e.g.
                                -cmd union -f file1.txt -f file2.txt -f file3.txt
                 -o             Output ChIP-seq file with the merged peaks

Example peaks:

File A:
        <---------->       <--------->
File B:
              <----->  <------>
File C:
                 <------>               <-------->
Output:
        <---------------------------->  <-------->

Annotate ChIP-seq peaks with gene information

./geneModel chip -cmd annotate-peaks [--gene] [--original] -i chip_seq_file.txt -o chip_seq_gene.txt
Options:
    --gene       if specified, output in gene centric view; shows for each gene the number of peaks in the promoter, gene body, and distal region.
    --original   show original peaks (and annotations)

Get distances to TSSs or TESs

./geneModel chip -cmd dist2tss [options]
Options:
                -i              input ChIP-seq file
                -maxdist        max. distance to a TSS/TES allowed
                -cutoff         how far should we look downstream of a TSS or upstream of a TES?
                --tes           use TESs instead of TSSs

Calculate the density of ChIP-seq binding sites around specified positions

./geneModel chip -cmd cal-density [options]
                -i              Query file containing the query positions in ChIP-seq format (use - to indicate STDIN).
                -chip           Reference ChIP-seq file.
                -o              Output file.
                -max            Maximum distance to each query position. We search for ChIP-seq peaks in this neighborhood.
                -sep            Field separator used when parsing the query file.
                --orig          Show original columns in input file. If not specified, show only the peak intervals and density.

Network related analyses

Output the degrees and annotations of genes in the network

./geneModel network -cmd degree -i network.sif -o output.txt
Options:
               -i               input SIF file
               -o               output file

Extract the N most connected genes (hubs) and perform PAGE pathway enrichment analysis

./geneModel network -cmd page -i network.sif -o output.txt -n topN
Options:
               -i               input SIF file
               -o               output PAGE file
               -n               top N hubs

Find connected sub-networks and output their component genes

./geneModel network -cmd subnet -i network.sif -o output.txt -n topN [--split]
Options:
               -i               input SIF file
               --split          if a node contains multiple gene names (e.g. "A1CF|GFER"), split the node according to the separator
               -sep             separator (default="|")
               -o               output file


Other functions

Perform Fisher's exact tests

This command performs Fisher's exact test on each line of the input file using data in the specified columns (-fields option). The four columns' values (a,b,c,d) are defined following the convention below (group x observation). Three columns will be appended to each line showing p-value(two.sides), p-value(greater) and p-value(less). Note that here we only deal with 2x2 contingency tables.

     | G1  |  G2
-----+-----+------
obs1 |  a  |   b
-----+-----+------
obs2 |  c  |   d
./geneModel util -cmd fisher -i my_counts.txt -fields 1,2,3,4 -o outfile_pval.txt  

Perform Benjamini–Hochberg correction for multiple hypothesis testing

This command performs Benjamini–Hochberg correction on the p-values in the specified column of the input file.

./geneModel util -cmd bh-correction -i infile_pval.txt -col 7 -o outfile_padj.txt
Additional options:
                -pval           output only records with adjusted p-values less than this threadshold
                --small         use small memory algorithm

Calculate the histogram based on the input column(s) of a file

E.g. Use data in columns 7 and 8 of input_file.txt.gz and calculate the histogram with min=0, max=15000, and bin size=25.
./geneModel util -cmd cal-histogram -i input_file.txt.gz -min 0 -max 15000 -bin 25 -cidx 7,8 -o output_histogram.txt

Merge rows of the same key and output the averaged values per specified column per key

E.g. Use column 6 (gene symbol) of input_file.txt as key and output averaged values for columns 1,2,3,4. 

./geneModel util -cmd merge-row-val -i input_file.txt -kidx 6 -vidx 1,2,3,4 > merged.txt

input_file.txt
NM_001042697    28.1     38.9     17.6     10.2    9.7     ZSWIM7
NM_001042698    28.9     39.2     18.6     11.3    10.9    ZSWIM7

merged.txt
ZSWIM7  28.5     39.05    18.1     10.75

Find the intersection between two lists of items

./geneModel util -cmd list-overlap -f1 list1.txt -f2 list2.txt [--print]
options:
use -idx1 and -idx2 to specify which columns in the files the items are in (default=0).

Find the difference between two lists of items (set2 - set1)

./geneModel util -cmd list-overlap -f1 list1.txt -f2 list2.txt --diff [--print]
options:
use -idx1 and -idx2 to specify which columns in the file the items are in (default=0).

Filtering: compare column(s) of a file to a reference list

Print records whose specified columns contain any of the items provided in the master list/reference file.

./geneModel util -cmd filter-from-list
Options:
                -i              Input file
                -tgidx          Column indices in the input (target) file (comma-separated)
                -list           Master list/reference file
                -lidx           Column index in the list file
                -match          Tag to show when the query columns are in the list file. if not specified, the matching key will be shown
                --showall       If specified, show all lines whether or not the query columns match the list file

Find the overlap between two files based on multiple columns

This can be used when the key (e.g. chromosomal region) is split into several fields (e.g. chr, start pos, end pos). Lines in file2 with keys that already appeared in file1 will be output.

E.g. the following command prints out the lines in file2.txt whose columns 0,1,2 appear in file1.txt. 
./geneModel util -cmd file-overlap -f1 file1.txt -f2 file2.txt -idx1 0,1,2 -idx2 0,1,2 > output_file

Find the difference between two files based on multiple columns

This can be used when the key (e.g. chromosomal region) is split into several fields (e.g. chr, start pos, end pos). Lines in file2 with keys not seen in file1 will be output.

E.g. the following command prints out the lines in file2.txt whose columns 0,1,2 are not in file1.txt. 
./geneModel util -cmd file-difference -f1 file1.txt -f2 file2.txt -idx1 0,1,2 -idx2 0,1,2 > output_file

Extract columns from multiple files and merge by key (row)

E.g. Here we have three files containing gene expression values from four microarray (exp_array.txt) and RNA-seq experiments (rna001_rpkm.txt and rna002_rpkm.txt). We want to merge these files and output all four expression values for every gene. Let's say the input files have the following format:

exp_array.txt:

(format: gene, expression in exp1, expression in exp2)
AAA   8.305    5.506        

rna001_rpkm.txt:

(format: gene, transcript, total length of exons, number of reads, rpkm)
AAA     NM_XXX       9342    4653    3.17929

and rna002_rpkm.txt:

(format: gene, transcript, total length of exons, number of reads, rpkm)
AAA     NM_XXX        918     4188    0.339037        

We can then extract the gene expression values by specifying the columns where the keys (genes) and expression values are using:

./geneModel util -cmd merge-col -f output/exp_array.txt -f output/exp_array.txt -f output/rna001_rpkm.txt -f output/rna002_rpkm.txt \
                                   -key 0,0,0,0 -val 1,2,4,4 -o output/exp_RNAseq_array.txt
Additional option:
            -missing     what to print when a key does not exist in the input file (default= "")

The output will be something like:

 AAA  8.305    5.506   3.17929  0.339037

Convert numerical chr ids (1..24) to string chr ids (chr1..chrY) in the specified column of a file

./geneModel util -cmd convert-num -i file.txt -col 0

If input file name is empty, the program reads in the data stream from STDIN.

Displaying all commands

./geneModel help all

Utility scripts

Generate SGE script files from a command file (one SGE file per command line)

scripts/makeSGEjob_per_line.pl -input batchHic2011.sh -sge qHiC2011 -wall 5:00:00
 
This will generate SGE scripts (e.g. qHiC2011_0.sh). To submit the SGE jobs, use:

for i in `ls qHiC2011_*.sh`; do qsub $i; done
options for makeSGEjob_per_line.pl:
-input   input file containing command lines
-sge     output SGE script file base name
-wall    wall time
-inst    additional instructions for the SGE scheduler (e.g. -q to specify the platform)
Personal tools